مقالههای دارای تعهدات انتشار عمومی - Arie O. Verkerkبیشتر بدانید
درمجموعZonMwDHFNWOEuropean CommissionLeducq Foundation, USANIHKNAWDFGANRMRCCIHRHelmholtzBHFWellcomeBMBFNKFISNSFFRQSINSERMNIHRAHAARCNHMRCFWONSERCEMBLNational Centre for the Replacement, Refinement and Reduction of Animals in Research, UKGovernment of SpainNMRCUK Research & InnovationHFSPMedical Research Future Fund, AustraliaCZI
جای دیگری دردسترس نیست: ۵
Transcriptome analysis of mouse and human sinoatrial node cells reveals a conserved genetic program
VWW Van Eif, S Stefanovic, K Van Duijvenboden, M Bakker, V Wakker, ...
Development 146 (8), dev173161, 2019
تعهدات: Netherlands Organisation for Scientific Research, Netherlands Organisation …
Enhanced late sodium current underlies pro-arrhythmic intracellular sodium and calcium dysregulation in murine sodium channelopathy
MR Rivaud, A Baartscheer, AO Verkerk, L Beekman, S Rajamani, ...
International journal of cardiology 263, 54-62, 2018
تعهدات: Netherlands Organisation for Scientific Research, Netherlands Organisation …
‘Mature’resting membrane potentials in human-induced pluripotent stem cell-derived cardiomyocytes: fact or artefact?
AO Verkerk, CA Remme
EP Europace 21 (12), 1928-1928, 2019
تعهدات: Netherlands Organisation for Scientific Research, Netherlands Organisation …
Down the rabbit hole: deciphering the short QT syndrome
AO Verkerk, CA Remme
European Heart Journal 40 (10), 854-856, 2019
تعهدات: Netherlands Organisation for Health Research and Development, Dutch Heart …
Knock-in swine model reveals new arrhythmia mechanism in Timothy syndrome
BJ Boukens, AO Verkerk, CR Bezzina
Nature cardiovascular research 3 (1), 18-20, 2024
تعهدات: Netherlands Organisation for Health Research and Development, Dutch Heart …
جای دیگری دردسترس است: ۹۷
Common variants at SCN5A-SCN10A and HEY2 are associated with Brugada syndrome, a rare disease with high risk of sudden cardiac death
CR Bezzina, J Barc, Y Mizusawa, CA Remme, JB Gourraud, F Simonet, ...
Nature genetics 45 (9), 1044-1049, 2013
تعهدات: US National Institutes of Health, German Research Foundation, National …
Atrial‐like cardiomyocytes from human pluripotent stem cells are a robust preclinical model for assessing atrial‐selective pharmacology
HD Devalla, V Schwach, JW Ford, JT Milnes, S El‐Haou, C Jackson, ...
EMBO molecular medicine 7 (4), 394-410, 2015
تعهدات: European Commission, Netherlands Organisation for Health Research and …
Immaturity of human stem-cell-derived cardiomyocytes in culture: fatal flaw or soluble problem?
CC Veerman, G Kosmidis, CL Mummery, S Casini, AO Verkerk, M Bellin
Stem cells and development 24 (9), 1035-1052, 2015
تعهدات: European Commission
Expansion and patterning of cardiovascular progenitors derived from human pluripotent stem cells
MJ Birket, MC Ribeiro, AO Verkerk, D Ward, AR Leitoguinho, ...
Nature biotechnology 33 (9), 970-979, 2015
تعهدات: National Centre for the Replacement, Refinement and Reduction of Animals in …
Identification and functional characterization of cardiac pacemaker cells in zebrafish
F Tessadori, JH van Weerd, SB Burkhard, AO Verkerk, E de Pater, ...
Public Library of Science 7 (10), e47644, 2012
تعهدات: Royal Netherlands Academy of Arts and Sciences
HCN4 Mutations in Multiple Families With Bradycardia and Left Ventricular Noncompaction Cardiomyopathy
A Milano, AMC Vermeer, EM Lodder, J Barc, AO Verkerk, AV Postma, ...
Journal of the American College of Cardiology 64 (8), 745-756, 2014
تعهدات: Netherlands Organisation for Health Research and Development, Royal …
RBM20 mutations induce an arrhythmogenic dilated cardiomyopathy related to disturbed calcium handling
MMG van den Hoogenhof, A Beqqali, AS Amin, I van der Made, S Aufiero, ...
Circulation 138 (13), 1330-1342, 2018
تعهدات: Netherlands Organisation for Scientific Research, Dutch Heart Foundation
Recessive cardiac phenotypes in induced pluripotent stem cell models of Jervell and Lange-Nielsen syndrome: disease mechanisms and pharmacological rescue
M Zhang, C D’Aniello, AO Verkerk, E Wrobel, S Frank, ...
Proceedings of the National Academy of Sciences 111 (50), E5383-E5392, 2014
تعهدات: European Commission, Netherlands Organisation for Health Research and …
Ion channelopathies in human induced pluripotent stem cell derived cardiomyocytes: a dynamic clamp study with virtual IK1
RME Meijer van Putten, I Mengarelli, K Guan, JG Zegers, ...
Frontiers in physiology 6, 7, 2015
تعهدات: German Research Foundation
TECRL, a new life‐threatening inherited arrhythmia gene associated with overlapping clinical features of both LQTS and CPVT
HD Devalla, R Gélinas, EH Aburawi, A Beqqali, P Goyette, C Freund, ...
EMBO molecular medicine 8 (12), 1390-1408, 2016
تعهدات: Swiss National Science Foundation, European Commission, Netherlands …
PDZ Domain–Binding Motif Regulates Cardiomyocyte Compartment-Specific NaV1.5 Channel Expression and Function
D Shy, L Gillet, J Ogrodnik, M Albesa, AO Verkerk, R Wolswinkel, ...
Circulation 130 (2), 147-160, 2014
تعهدات: Swiss National Science Foundation, US National Institutes of Health …
Genome-wide association analyses identify new Brugada syndrome risk loci and highlight a new mechanism of sodium channel regulation in disease susceptibility
J Barc, R Tadros, C Glinge, DY Chiang, M Jouni, F Simonet, SJ Jurgens, ...
Nature genetics 54 (3), 232-239, 2022
تعهدات: US National Institutes of Health, American Heart Association, Research …
Unique cardiac Purkinje fiber transient outward current β-subunit composition: a potential molecular link to idiopathic ventricular fibrillation
L Xiao, TT Koopmann, B Ördög, PG Postema, AO Verkerk, V Iyer, ...
Circulation research 112 (10), 1310-1322, 2013
تعهدات: US National Institutes of Health, Canadian Institutes of Health Research
Human iPSC-derived cardiomyocytes for investigation of disease mechanisms and therapeutic strategies in inherited arrhythmia syndromes: strengths and limitations
S Casini, AO Verkerk, CA Remme
Cardiovascular drugs and therapy 31 (3), 325-344, 2017
تعهدات: Netherlands Organisation for Scientific Research, Netherlands Organisation …
hiPSC-derived cardiomyocytes from Brugada Syndrome patients without identified mutations do not exhibit clear cellular electrophysiological abnormalities
CC Veerman, I Mengarelli, K Guan, M Stauske, J Barc, HL Tan, ...
Scientific reports 6 (1), 30967, 2016
تعهدات: Netherlands Organisation for Scientific Research, Dutch Heart Foundation
اطلاعات انتشارات و تأمین بودجه بهطورخودکار توسط برنامه رایانهای تعیین میشود.